SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_074318267.1.89665 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_074318267.1.89665
Domain Number 1 Region: 171-399
Classification Level Classification E-value
Superfamily Lysozyme-like 3.66e-84
Family Chitosanase 0.0000000873
Further Details:      
 
Domain Number 2 Region: 38-156
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.43e-40
Family Ricin B-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_074318267.1.89665
Sequence length 400
Comment glycoside hydrolase [Micromonospora cremea]; AA=GCF_900143515.1; RF=representative genome; TAX=709881; STAX=709881; NAME=Micromonospora cremea; strain=DSM 45599; AL=Contig; RT=Major
Sequence
MLRKRSAAYVVGALLVGTAALGYGLPSASAAAAGPITGLGGKCVDVAGASPANGTPVQLY
DCNGSAAQTWTVGNADGSIRALGKCLDVTAASTADGAKVQLYDCNSTGAQKWTASNGALV
NGGSGKCLDVTDRSTANGTRLQIWSCSGGTNQRWTLPGGGTPPPTTPTVRNLDDPAKKDV
AMQLVSAAENSSLDWRAQFSYIEDIGDGRGYTAGIIGFCSGTGDMLELVEAYTRTKPGNV
LASYLPALRAVNGTDSHAGLDPSFPRDWRAAATDPVFRAAQEAERDRVYFNPSVRDGKTD
QVRALGQFAYYDAAVMHGYEGIRAIRNRALARAKPPAQGGDERTWLNAFLDERVIEMKKE
AAHSDTSRVDTAQRVFLNNGNVDLNTPLVFAVYGEQFRIG
Download sequence
Identical sequences A0A1N6B4T9
WP_074318267.1.89665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]