SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_074855771.1.57345 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_074855771.1.57345
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.27e-41
Family SMI1/KNR4-like 0.00000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_074855771.1.57345
Sequence length 135
Comment SMI1/KNR4 family protein [Pseudomonas oleovorans]; AA=GCF_002091815.1; RF=na; TAX=1218072; STAX=301; NAME=Pseudomonas oleovorans subsp. oleovorans NBRC 13583 = DSM 1045; strain=NBRC 13583; AL=Contig; RT=Major
Sequence
MEEVIEQLRELNEPVPVPLELPEEETLVEIQEQILIHLPFELREYLLKVSDVVYGRLEPV
TASDPHSHTYLPEVASVAWDLGLPRDLVPLCQDGRDYYAVDVEGQVWLWDGDEGELTDES
WDSVWHWCRDVWLES
Download sequence
Identical sequences A0A087FF43 A0A1H6UB97 A0A225EED8
WP_074855771.1.21710 WP_074855771.1.57345 WP_074855771.1.95985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]