SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_076096740.1.8412 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_076096740.1.8412
Domain Number 1 Region: 179-382
Classification Level Classification E-value
Superfamily Lysozyme-like 1.69e-69
Family Family 19 glycosidase 0.00000994
Further Details:      
 
Domain Number 2 Region: 47-166
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.72e-40
Family Ricin B-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_076096740.1.8412
Sequence length 382
Comment chitinase [Streptomyces sp. IMTB 2501]; AA=GCF_001953885.1; RF=na; TAX=1776340; STAX=1776340; NAME=Streptomyces sp. IMTB 2501; strain=IMTB 2501; AL=Scaffold; RT=Major
Sequence
MHLRLAETPHRRSRLRRLGRFLAGGVAATLLTALFTATPAQAADGQITGLAGRCVDVAGA
DSANGTAVQLYDCNGTNAQIWSNPGDGTLRALGKCLDVVDRGTADGAAVQLWDCGGGANQ
QWVVTAAHDIVNPQANKCLDVRDNNSANGTRLQIWTCSGGANQKWNAPADGGSGTPSRFV
VSEAQFNQMFPNRNSFYTYSGLVQALGAYPGFANTGRDTVKKQEAAAFLANVSHETGGLV
YVVEQNTANYPTYCDWSQPYGCPAGQAAYYGRGPLQLSWNFNYKAAGDALGIDLLNNPWQ
VENDPAVAWKTGLWYWNTQSGPGTMTPHDAMVNQAGFGQTIRSINGSLECDGKNPAQVQS
RVDAYQRFTQILGVPPGSNLYC
Download sequence
Identical sequences A0A1R0L9Y3
WP_076096740.1.8412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]