SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_077175787.1.89494 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_077175787.1.89494
Domain Number 1 Region: 8-107
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 7.06e-16
Family SMI1/KNR4-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_077175787.1.89494
Sequence length 113
Comment MULTISPECIES: hypothetical protein [Burkholderia cepacia complex]; AA=GCF_001993095.1; RF=na; TAX=95486; STAX=95486; NAME=Burkholderia cenocepacia; strain=VC5402; AL=Contig; RT=Major
Sequence
MSVLYGEKPAQPLLGKLEAELGFVLPADYKDFLKKWNGIFIGGADYLDFDFPGVDNGIIS
FASLFGVGTSNENFDLIEQNERVRGEVDFLNDFFVIGDDPGGNYYALARFDNV
Download sequence
Identical sequences A0A095GUJ0
WP_077175787.1.100899 WP_077175787.1.19997 WP_077175787.1.22782 WP_077175787.1.24442 WP_077175787.1.25444 WP_077175787.1.29022 WP_077175787.1.31271 WP_077175787.1.37542 WP_077175787.1.40482 WP_077175787.1.46998 WP_077175787.1.50276 WP_077175787.1.52578 WP_077175787.1.54239 WP_077175787.1.63423 WP_077175787.1.64825 WP_077175787.1.66286 WP_077175787.1.66837 WP_077175787.1.69013 WP_077175787.1.7038 WP_077175787.1.783 WP_077175787.1.78542 WP_077175787.1.79921 WP_077175787.1.8203 WP_077175787.1.82703 WP_077175787.1.83617 WP_077175787.1.85815 WP_077175787.1.86925 WP_077175787.1.87716 WP_077175787.1.89494 WP_077175787.1.89848 WP_077175787.1.89939 WP_077175787.1.9034 WP_077175787.1.96852 WP_077175787.1.9698 WP_077175787.1.98819 WP_077175787.1.99341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]