SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_078080015.1.32704 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_078080015.1.32704
Domain Number 1 Region: 164-367
Classification Level Classification E-value
Superfamily Lysozyme-like 5.06e-64
Family Family 19 glycosidase 0.000011
Further Details:      
 
Domain Number 2 Region: 32-151
Classification Level Classification E-value
Superfamily Ricin B-like lectins 9.41e-41
Family Ricin B-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_078080015.1.32704
Sequence length 367
Comment chitinase [Streptomyces niveus]; AA=GCF_002009175.1; RF=representative genome; TAX=193462; STAX=193462; NAME=Streptomyces niveus; strain=SCSIO 3406; AL=Complete Genome; RT=Major
Sequence
MSLVRSAILLAVAALIATLFTAPAAQAADGQITGLAGKCVDVAGANSANGTPVQLYDCNG
SNAQRWSNSGDGTLRALGKCLDVSGNSTADGALVHLWDCTGGANQRWVVSGANDIVNPQA
NKCLDVQDRNSANGARLQIWTCSGQSNQKWNAPPSGGGGNPGGFVVSEAQFNQMFPSRNG
FYSYSGLTAALSAYPAFATTGSDTVKRQEAAAFLANVSHETGGLVHIVEQNTANYPHYCD
TSQSYGCPAGQAAYYGRGPIQLSWNFNYKAAGDALGINLLADPWRVQNDSAVAWKTGLWY
WNTQNGPGTMTPHNAMVNQAGFGQTIRSINGSLECDGRNPATVQSRINNYQRFTQILGVA
PGGNLYC
Download sequence
Identical sequences A0A1U9R4M2
WP_078080015.1.32704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]