SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_078494526.1.99913 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_078494526.1.99913
Domain Number 1 Region: 161-364
Classification Level Classification E-value
Superfamily Lysozyme-like 8.15e-68
Family Family 19 glycosidase 0.00000964
Further Details:      
 
Domain Number 2 Region: 9-132
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.44e-36
Family Ricin B-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_078494526.1.99913
Sequence length 364
Comment chitinase [Streptomyces niveus]; AA=GCF_001723075.1; RF=na; TAX=193462; STAX=193462; NAME=Streptomyces niveus; strain=NRRL 2449; AL=Scaffold; RT=Major
Sequence
MSLAADSVGGPITGFAGKCVDVADGNSTSGTTVQLYDCNGTPAQQWSNPGDGTLRAFGKC
LDIRGGGTADAADVQLWDCNGGPAQQWVVSQANDIVNPAANKCLDVRAYNSANRTPLQIW
PCQGAENEKWYLSGGGSPASGPDVPPVGDGGGGDDESTSGFVVSEAQFNQMFPNRNALYN
YEGLKAALSAYPAFATSGDDTAKKREAAAFLANIGHETGGLVHAVEQNTANYSAYCDASQ
PYGCPAGQDAYHGRGPIQLSWNYNYKAAGDALGIDLLNNPDLVETDAAVAWKTGLWYWNT
QTGPGTMTGHDAMVNGAGFGQTIRTINGALECDGRNPAQVQSRVDSYQGFTQLLGVAPGD
NLSC
Download sequence
Identical sequences WP_078494526.1.10790 WP_078494526.1.99913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]