SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_078620271.1.86741 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_078620271.1.86741
Domain Number 1 Region: 180-383
Classification Level Classification E-value
Superfamily Lysozyme-like 1.41e-65
Family Family 19 glycosidase 0.0000136
Further Details:      
 
Domain Number 2 Region: 46-165
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.01e-40
Family Ricin B-like 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_078620271.1.86741
Sequence length 383
Comment chitinase [Streptomyces sp. BoleA5]; AA=GCF_000373665.1; RF=na; TAX=1157637; STAX=1157637; NAME=Streptomyces sp. BoleA5; strain=BoleA5; AL=Scaffold; RT=Major
Sequence
MSTSLAGRLPTGRTVLGPSAVFAVLAALLATLFVATPTARAADGQISGLAGKCVDVAGAN
NANGTAVQLYDCNGTGAQRWSNPGDGTLRALGKCLDVVDRSTADGAAVQLWDCSGSANQQ
WVVTAARDIVNPAADKCLDVRDNSSANATRLQIWTCTGGANQKWNAPASGGGGGTNPSGF
VVSESQFNQMFPGRNGFYTYSGLVAALSSYPGFANSGGDTVKKQEAAAFLANVSHETGGL
VYVVEQNTANYPHYCDWGQPYGCPAGQAAYYGRGPIQLSWNFNYKAAGDALGIDLLGNPW
RVEQDAAVAWRTGLWYWNTQSGPGSMTPHNAMVNQAGFGQTIRSINGSLECDGRNPAQVQ
SRVTKYQQFTAILGVSPGANLYC
Download sequence
Identical sequences WP_078620271.1.86741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]