SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_079061506.1.78314 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_079061506.1.78314
Domain Number 1 Region: 181-384
Classification Level Classification E-value
Superfamily Lysozyme-like 2.64e-69
Family Family 19 glycosidase 0.00000788
Further Details:      
 
Domain Number 2 Region: 50-168
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.4e-39
Family Ricin B-like 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_079061506.1.78314
Sequence length 384
Comment chitinase [Streptomyces griseoruber]; AA=GCF_001514205.1; RF=na; TAX=1943; STAX=1943; NAME=Streptomyces griseoruber; strain=DSM 40281; AL=Scaffold; RT=Major
Sequence
MPTSLVHQLPERRASSGNSTVLTALTVLVALIAALFVAAPTAAAADGQIKGLAGKCVDVA
SANSANGASVQLYDCNGTNAQIWSNPGDGTLRALGKCLDVVERSTADGAAVQLWDCTGGA
NQQWVVTAARDIVNPAADKCLDVREKNSANGTRLQIWTCTGTSNQKWTAPASGGGTTPSG
FVVSEAQFNQMFPNRNSFYTYNGLVQALSSYPAFAKTGSDTVRKQEAAAFLANVNHETGG
LVHVVEQNTANYPHYCDLSQSYGCPAGQAAYYGRGPIQLSWNFNYKAAGDALGIDLLRNP
RLVETDAAVAWRTGLWFWNTSTGAGTMTPHNAMVNQAGFGQTIRAINGSLECDGKNPGQV
QSRVSAYQRFTAILGVGPGGNLSC
Download sequence
Identical sequences WP_079061506.1.100133 WP_079061506.1.78314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]