SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_079307337.1.47999 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_079307337.1.47999
Domain Number 1 Region: 168-371
Classification Level Classification E-value
Superfamily Lysozyme-like 5.62e-68
Family Family 19 glycosidase 0.00000825
Further Details:      
 
Domain Number 2 Region: 36-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.23e-41
Family Ricin B-like 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_079307337.1.47999
Sequence length 371
Comment chitinase [Streptomyces sp. GKU 895]; AA=GCF_002027195.1; RF=na; TAX=1662404; STAX=1662404; NAME=Streptomyces sp. GKU 895; strain=GKU 895; AL=Contig; RT=Major
Sequence
MPFSPRAARLPVLAALFAVLTALLTVTPAHAASGSISGLAGKCVDVAGANAANGTAVQLY
DCNGTGAQIWSNSGDGTLRALGKCLDVVDRSTADGAAVQLWDCSGSANQQWVVTAARDIV
NPAANKCLDVRDNNSANGTRLQIWTCSGTANQKWNAPASGGGGAPSGFVVSEAQFNQMFP
NRNSFYTYSGLVAALSSYPGFANTGSDTVKKQEAAAFLANVNHETGGLVYVVEQNTANYP
HYCDWSQSYGCPAGQAAYYGRGPIQLSWNFNYKAAGDALGLDLLNNPWLVQNDASVAWRT
GLWYWNTQSGPGTMTPHNAMVNQAGFGQTIRSINGSLECDGRNPAQVQSRVDAYNRFTSI
LGVSPGGNLYC
Download sequence
Identical sequences A0A1V4E9L2
WP_079307337.1.47999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]