SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_080510373.1.54323 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_080510373.1.54323
Domain Number 1 Region: 405-494
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000000000051
Family Carboxypeptidase regulatory domain 0.034
Further Details:      
 
Domain Number 2 Region: 491-559
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.0000000000942
Family Cna protein B-type domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_080510373.1.54323
Sequence length 572
Comment hypothetical protein [Halorubrum coriense]; AA=GCF_000337035.1; RF=representative genome; TAX=1227466; STAX=64713; NAME=Halorubrum coriense DSM 10284; strain=DSM 10284; AL=Contig; RT=Major
Sequence
MSTLRIYDTKGNAYSPDGTATGSNEQVKELFYGGVRLAIRSDHRREISLFFRARETRNAR
TEQFYAVYSVDDSSTPLQDLITDLTTRVESEWGYSIDDSSEEMQVYRDLKRGNTALPGGS
TEQGILSKLISSRQPVVVGVQDERNAIGLLSEYLDEYDQAAIADSEDADVLSTFDFVVTP
NGTRGITPLGETEARWESTSRSLRDKHIKQEIASIRESVETLSREHGLSNGEIRDRIQSS
VPALKASTTSSDLRTSASGSDDDYLVPPKVGLYVAVGAAVLLVLFAAIYFGVFGFIGATN
GSGQTSSQANITGVVIDSTTGNPLNSSTRNVYVTLNNETGAVVKNASQPQYAFTVSKARL
SNLTLKASADGYQNQTRDLSGDSREINISLVPASTDADSATLSRVQGQVVDSTNDAAISD
ANISLIGTENRVVKTNLIGNYTFEEIPPGEYTLSVTADGYVASESRTISVNGTTTQVDDI
NLDPTAALSILVTDSNADAGVAGASVYLYDNSTRKSVNSSTTDQAGWYNVSDLAPGTYDI
EARPDGYDNKEKTYEVKPGAARVIEITVISDS
Download sequence
Identical sequences WP_080510373.1.54323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]