SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_081980810.1.87483 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_081980810.1.87483
Domain Number 1 Region: 209-331
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.01e-19
Family Heme-binding PAS domain 0.04
Further Details:      
 
Domain Number 2 Region: 392-597
Classification Level Classification E-value
Superfamily PP2C-like 0.0000199
Family PP2C-like 0.019
Further Details:      
 
Domain Number 3 Region: 167-214
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000497
Family HAMP domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_081980810.1.87483
Sequence length 599
Comment hypothetical protein [Neosynechococcus sphagnicola]; AA=GCF_000775285.1; RF=representative genome; TAX=1497020; STAX=1501145; NAME=Neosynechococcus sphagnicola sy1; strain=CAUP A 1101; AL=Contig; RT=Major
Sequence
MDATLLKLPEIQKNLAEIHLISQQAILRGRILPSEQAKLMLLGVNLKQFRANLKQKIAVA
FANNPKGNLVPQLTEPLTLLTEDVGKLTELLLPLDARQPLQLKQILAQANQSLLQSFQFW
NTAIDELDILLQNRIDGFFRKQVFLTTFVLIILAIVCYLFVGFYLSVMQTISGLSAAADR
MINGNFSEEMALESHDELTEVVQSFNNIADALREAEAKYRGIFENAVEGIFQTTQTGNYL
IANPMLARIYGYDSAEELITALTDIEHQLYVDPHRRSEFTQLIAAQGKVQGFESQVYCKD
GSIIWISESVRAIQDPLGEVIGYEGTVEDITQRKLAEAEIIQLTQRLKHENLRMGAELEV
SRQLQTMLLPSDAELEAVIGLEIAGFMEPAAEVGGDYYDVLQHEGKIRIGIGDVTGHGLE
SGVVMLMAQTAVRTLLTHGETDPTRFLNTVNTIIYENTQRMRSPKNMTLALLNYEAGMLS
LSGQHEEVIIVRRDGRIEPIDTLDLGFPLGLESDITSFVAETQIQLQSGDIAVLYTDGIT
EAMNAQRQQYGLDRMYGILRRHCEDSASNIRQAIIEDLREFIGDQKVFDDITLLILKQR
Download sequence
Identical sequences WP_081980810.1.87483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]