SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_082377263.1.8361 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_082377263.1.8361
Domain Number 1 Region: 135-364
Classification Level Classification E-value
Superfamily Lysozyme-like 3.37e-85
Family Chitosanase 0.0000000862
Further Details:      
 
Domain Number 2 Region: 4-121
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.32e-39
Family Ricin B-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_082377263.1.8361
Sequence length 365
Comment glycoside hydrolase [Micromonospora sp. NRRL B-16802]; AA=GCF_001279555.1; RF=na; TAX=1415541; STAX=1415541; NAME=Micromonospora sp. NRRL B-16802; strain=NRRL B-16802; AL=Contig; RT=Major
Sequence
MTGLGGKCVDVAAANTANGTPIQLYDCNGTAAQTWTVGNTDNSIRALGKCLDVTAASSAD
GAKVQLYDCNNTGAQKWTASNGALVNTGSGKCLDVTDRNTANGTRLQIWTCSGTTNQRWT
LPGGGTPTPTTPTGVNLDDPAKKDVAMQLVSAAENSSLDWRAQFSYIEDIGDGRGYTAGI
IGFCSGTGDMLELVEAYTRAKPGNVLAAYLPALRAVNGTDSHAGLDPNFPRDWRTAATDS
AFRAAQEAERDRVYFNPSVRDGKNDQVRALGQFAYYDAAVMHGYEGMRQIRSRALTRAKP
PAQGGDERTWLNAFLDERVIEMRKEAAHSDTSRVDTAQRVFLNNGNFDLNTPLVFAVYGD
QFRIG
Download sequence
Identical sequences WP_082377263.1.8361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]