SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_083449372.1.46567 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_083449372.1.46567
Domain Number 1 Region: 168-371
Classification Level Classification E-value
Superfamily Lysozyme-like 8.72e-67
Family Family 19 glycosidase 0.0000092
Further Details:      
 
Domain Number 2 Region: 40-160
Classification Level Classification E-value
Superfamily Ricin B-like lectins 6.31e-36
Family Ricin B-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_083449372.1.46567
Sequence length 371
Comment chitinase [Actinoplanes rectilineatus]; AA=GCF_000962825.1; RF=representative genome; TAX=113571; STAX=113571; NAME=Actinoplanes rectilineatus; strain=NRRL B-16090; AL=Contig; RT=Major
Sequence
MSSPDRRSRTLLAALLSLVTAVGLLTLTTGPAAAAATGQITGLAGKCIGAAGGNTAGGTA
IDLYSCVGDATQQWTLPGDGTIRTAGKCMDLSNAGTADGTKVQLWDCNGTVAQQWIFSSA
RDLVNPNANKCLDLTGGSSADFTVVQLWTCNGTGAQKWTVPTSSGSGFVVTEAQFNQMFP
GRNGFYTYSGLVAAISAYPGFAGTGSDTVRKQEAAAFLANVGHETGGLVYIVEQNTANYP
HYCDWGQPFGCPAGQSAYYGRGPIQLSWNYNYKAAGDALGIDLLNNPWLVQNDAAVSWKT
GLWFWMTSTGAGSMTGHNAMVTSAGFGQTIRTINGSLECDGRNPGQVQSRVDAYLRFTQI
LGVAAGTNLYC
Download sequence
Identical sequences WP_083449372.1.46567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]