SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_086725249.1.90004 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_086725249.1.90004
Domain Number 1 Region: 149-352
Classification Level Classification E-value
Superfamily Lysozyme-like 5.06e-67
Family Family 19 glycosidase 0.0000102
Further Details:      
 
Domain Number 2 Region: 18-136
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.69e-40
Family Ricin B-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_086725249.1.90004
Sequence length 352
Comment chitinase [Streptomyces carpinensis]; AA=GCF_002154505.1; RF=na; TAX=66369; STAX=66369; NAME=Streptomyces carpinensis; strain=NRRL B-16921; AL=Scaffold; RT=Major
Sequence
MAALFTAAPAHAADGQITGLAGKCVDVAGANSANGTAVQLYDCNGTSAQRWSNAGDGTLR
ALGKCLDVVDRGTGDGAAVQLWDCSGGANQQWVVTAAHDIVNPAADKCLDVRDNNSANGT
RLQIWTCTGGANQKWNAPGGGGGSSLSGFVVTEAQFNQMFPHRNGFYAYNGLVQALSSYP
AFANTGSDAVKKQEAAAFLANVSHETGGLVYVVEQNTANYPHYCDWSQSYGCPAGQAAYY
GRGPLQLSWNFNYKAAGDALGIDLLGNPWLVQNDAAVAWRTGLWYWNTQSGPGSMTPHNA
MVNQAGFGQTIRSINGSLECDGKNPAQVQSRVDAYQRFTAILGVSPGSGLYC
Download sequence
Identical sequences WP_086725249.1.90004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]