SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_088951829.1.14288 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_088951829.1.14288
Domain Number 1 Region: 154-384
Classification Level Classification E-value
Superfamily Lysozyme-like 1.04e-84
Family Chitosanase 0.0000000774
Further Details:      
 
Domain Number 2 Region: 22-141
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.97e-39
Family Ricin B-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_088951829.1.14288
Sequence length 385
Comment glycoside hydrolase [Micromonospora zamorensis]; AA=GCF_900090275.1; RF=na; TAX=709883; STAX=709883; NAME=Micromonospora zamorensis; strain=DSM 45600; AL=Chromosome; RT=Major
Sequence
MGVAAIGYGLPSASAATAGPITGLGGKCVDVAAANSANGTAVQLYDCNGSAAQTWTVGNT
DNSIRALGKCLDVTAASTANGAKIQLYDCNGTGAQKWTASNGALVNTGSGKCLDVTDQST
ANGARLQIWTCGGTTNQQWTLPGGGTPTPTTPTGTNLDDPAKKDVAMQLVSAAENSSLDW
RAQFSYIEDIGDGRGYTAGIIGFCSGTGDMLELVEAYTRTKPGNVLAGYLPALRAVNGTP
SHSGLDPNFPRDWRTAANDSVFQAAQEAERDRVYFNPSVRDGKNDQVRALGQFAYYDAAV
MHGYEGMRQIRNRALARAKPPAQGGDERAWLNAFLDERVIEMKKEAAHSDTSRVDTAQRV
FLNNGNFNLNTPLVFAVYGDQFRIG
Download sequence
Identical sequences WP_088951829.1.14288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]