SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_089211605.1.5288 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_089211605.1.5288
Domain Number 1 Region: 169-372
Classification Level Classification E-value
Superfamily Lysozyme-like 3.37e-64
Family Family 19 glycosidase 0.00000838
Further Details:      
 
Domain Number 2 Region: 35-159
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.24e-40
Family Ricin B-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_089211605.1.5288
Sequence length 372
Comment chitinase [Streptosporangium subroseum]; AA=GCF_900188345.1; RF=representative genome; TAX=106412; STAX=106412; NAME=Streptosporangium subroseum; strain=CGMCC 4.2132; AL=Scaffold; RT=Major
Sequence
MRKFLTGLTLPRTAVVLVLGVLLSALVTAPASAADPVGRITGLAGKCVDVAWANSANGTP
VQLQDCNGGNAQQWSVAGDGTLRALGKCLDIVDWSTADGAKVQLWDCAGSANQKWVVTPA
HDIVNPAANKCLDVTDNNSANGTRLQIWTCAGTANQKWNAPSTSATNGFVVSEAQFNQMF
PNRNGFYTYSGLVAALKAYPGFATTGSDTVKKQEAAAFLANVNHETGGLKYVTELNTANY
SHYCDWSQWYGCPAGQSAYYGRGPIQLSWNFNYKAAGDALGIDLLHNPWLVQNDASVAWK
TGLWFWNTQNGAGYMTPHNAMVSGAGFGQTIRSINGALECDNKYPAQVQSRVDAYRWFTQ
ILGVSAGSNLYC
Download sequence
Identical sequences WP_089211605.1.5288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]