SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_089294176.1.84645 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_089294176.1.84645
Domain Number 1 Region: 130-359
Classification Level Classification E-value
Superfamily Lysozyme-like 2.11e-86
Family Chitosanase 0.0000000582
Further Details:      
 
Domain Number 2 Region: 4-121
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.03e-38
Family Ricin B-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_089294176.1.84645
Sequence length 360
Comment glycoside hydrolase [Actinoplanes regularis]; AA=GCF_900188005.1; RF=representative genome; TAX=52697; STAX=52697; NAME=Actinoplanes regularis; strain=DSM 43151; AL=Scaffold; RT=Major
Sequence
MRGLGGKCIDVAGSATANGTAVQLYDCNGTAAQQWTVGNTDATIRALGKCMDVTAASTAN
GAKIQLYDCNATGAQKWTVSNGTLINTASGKCLDVTGKSTANGTRLQIWTCAGGTNQTWT
MPGGSTPTGKNLDDPAKKDVAMQIVSAAENSSLDWRAQFSYIEDIGDGRGYTAGIIGFCS
GTGDMLELVEAYTATKPSNVLARYLPALRAVNGTDSHAGLDPNFPRDWRTAAADPVFQAA
QESERDRVYFNPSVRDGKSDGVRALGQFAYYDAAVVHGYEGMRAIRSRALAKARPPAQGG
DERAWLNAFLDERVVEMKKEEAHSDTSRIDTAQRVFLNNGNFDLNTPLDFKVYGDPYHIG
Download sequence
Identical sequences WP_089294176.1.84645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]