SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_090014206.1.80353 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_090014206.1.80353
Domain Number 1 Region: 35-311
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.59e-45
Family beta-glycanases 0.0000208
Further Details:      
 
Domain Number 2 Region: 348-478
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.92e-31
Family Galactose-binding domain 0.082
Further Details:      
 
Domain Number 3 Region: 484-576
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000252
Family Cellulosomal scaffoldin protein CipC, module x2.1 0.011
Further Details:      
 
Domain Number 4 Region: 581-638
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000647
Family Type I dockerin domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_090014206.1.80353
Sequence length 639
Comment hypothetical protein [Clostridium sp. DSM 8431]; AA=GCF_900116755.1; RF=na; TAX=1761781; STAX=1761781; NAME=Clostridium sp. DSM 8431; strain=DSM 8431; AL=Scaffold; RT=Major
Sequence
MKKKHFLLGLFCALLFVLIVPSKAAFAATDETHPGFRVDGRFLYDNQGEKTVLYGINKMV
VWQDKDGDPSFREIAKTGANCVRIVWTMKDGTPDELDTAITNCRAEHMIPIIELHDATGE
FDKLQSLVDWWVKPEVVQVIQKHQEYLLVNIGNEVGDGNVSNDRFKTEYTKAVTRMREAG
IHVSLVIDPSSWGQNLNQLQACGLDIQSADPDHNCLFSAHLWWPYMYGHTDKEVVDELTE
SAEMGLPLVIGEFANQWEQSSQGQIPYKVIMEYCAKYEIGYLIWSWGPGNSPQTFLDMTT
DGNFDTLQPWAKEMLFDNEYSLSKLVKIPNSMLSGLPAQKPAKPLKAGNLALGKTVTFSS
KEDASYEGNNITDGNFDTRWASQSNSSNDWVCIDLGSTKDINEVLIKWENAYATQYKIQV
SNDGTSWDDVYQNYSGKGGLDDINLSSSVTARYVRINCSQKINYSWGYSIWELGIYGADS
EKAAIVSEDAAVFDKNVRKASDLTFSLNKNGNNLIQVKNGENILTESKDYTVSDNEIVIK
KSYLSSLEKGTIQLQLVFDNDLNTLINIAIGDTTPIGGNVILMGDINNDGEVDLADYTLL
RKYLNAATGTNIQINTEASDLNEDGEINFFDLVALKAAI
Download sequence
Identical sequences A0A1I7ISP7
WP_090014206.1.80353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]