SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_091400201.1.47857 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_091400201.1.47857
Domain Number 1 Region: 160-390
Classification Level Classification E-value
Superfamily Lysozyme-like 2.76e-84
Family Chitosanase 0.0000000812
Further Details:      
 
Domain Number 2 Region: 27-146
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.7e-40
Family Ricin B-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_091400201.1.47857
Sequence length 391
Comment glycoside hydrolase [Micromonospora saelicesensis]; AA=GCF_900091575.1; RF=na; TAX=285676; STAX=285676; NAME=Micromonospora saelicesensis; strain=DSM 44871; AL=Scaffold; RT=Major
Sequence
MGTLLVGVAAVGYGLPSASAATAGPITGLGGKCIDVAGASSANGTPVQLYDCNGSAAQTW
TVGNTDNSIRALGKCLDVTAASTANGAKVQLYDCNNTGAQKWTPSNGALVNSGSGRCLDV
TDRSTANGARLQIWTCGGTTNQRWTLPGGGSTPTPTTPSGTNLDDPAKKNVAMQLVSAAE
NSSLDWRAQFSYIEDIGDGRGYTAGIIGFCSGTGDMLELVEAYTRTKPGNVLAGYLPALR
NVNGTPSHAGLDPNFPRDWRTAATDSVFQAAQEAERDRVYFNPSVRDGKNDQVRALGQFA
YYDAAVMHGYEGMRQIRNRALNRAKPPAQGGDERTWLNAFLDERVIEMKKEEAHSDTSRV
DTAQRVFLNNGNFNLNTPLVFAVYGDQFRIG
Download sequence
Identical sequences WP_091400201.1.47857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]