SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_091601972.1.14091 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_091601972.1.14091
Domain Number 1 Region: 174-377
Classification Level Classification E-value
Superfamily Lysozyme-like 1.15e-65
Family Family 19 glycosidase 0.0000119
Further Details:      
 
Domain Number 2 Region: 43-162
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.48e-37
Family Ricin B-like 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_091601972.1.14091
Sequence length 377
Comment chitinase [Micromonospora mirobrigensis]; AA=GCF_900091555.1; RF=na; TAX=262898; STAX=262898; NAME=Micromonospora mirobrigensis; strain=DSM 44830; AL=Scaffold; RT=Major
Sequence
MTSPTNGRPRLRTWAALAVLATTCGVVTATGQPASAAATGPITGLAGKCIGAAGGRTANG
TAIDLYSCVGDPTQQWTLPGDGTIRTAGKCMDVAGAGTTDGTKVQLWDCNGTSAQQWVHT
GSRDLVNPHANKCLDLTGASSADLTVTQIWTCTGGANQKWNVPGGSTPPAPGGFVVSETQ
FNQMFPNRNGFYSYSGLVAAMSAYPQFTTSGSDTVRRQEAAAFLANVNHETGGLMYVVEL
NTANYPNYCDWGQPYGCPAGQAAYYGRGPLQLSWNFNYKAAGDALGLNLLGNPWLVQNDS
AVAWKTGLWFWMTSTGAGRMTGHDAMVNSAGFGETIRTINGSLECNGANPGQVQSRVDAY
QRFTQILGVPAGGNLYC
Download sequence
Identical sequences A0A1C4UL44
WP_091601972.1.14091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]