SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_092543866.1.39946 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_092543866.1.39946
Domain Number 1 Region: 168-371
Classification Level Classification E-value
Superfamily Lysozyme-like 1.01e-65
Family Family 19 glycosidase 0.0000104
Further Details:      
 
Domain Number 2 Region: 38-157
Classification Level Classification E-value
Superfamily Ricin B-like lectins 6.49e-35
Family Ricin B-like 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_092543866.1.39946
Sequence length 371
Comment chitinase [Actinoplanes derwentensis]; AA=GCF_900104725.1; RF=representative genome; TAX=113562; STAX=113562; NAME=Actinoplanes derwentensis; strain=DSM 43941; AL=Chromosome; RT=Major
Sequence
MSSPDLRRTLLAVLLSVTTAVGLLGLTGTAAHAATGTITGLAGKCIGAAGGSTGNGTAVD
LYACVGDATQQWSRPGDGTIRTAGRCLDVSNAGTADGTKVQLWDCNGSVAQQWVFSSARD
LVNPNANKCLDLTGGSSADFTVVQLWTCNGTGAQKWNAPASGGSTGGFVVTEAQFNQMFP
GRNGFYSYSGLVTAISAYPAFAGAGSDTVRKQEAAAFLANVNHETGGLVHIVEQNTANYP
HYCDWNQSFGCPAGQSAYYGRGPIQLSWNYNYKAAGDALGIDLLNNPWLVQNDAAVSWKT
GLWFWMTSTGAGTMTGHNAMVNSAGFGQTIRTINGSLECNGANPGQVQSRVDAYLRFTQI
LGVAAGSNLYC
Download sequence
Identical sequences A0A1H1WLA5
WP_092543866.1.39946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]