SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_093198791.1.43806 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_093198791.1.43806
Domain Number 1 Region: 117-249
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.23e-26
Family GntR ligand-binding domain-like 0.011
Further Details:      
 
Domain Number 2 Region: 5-77
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.38e-23
Family GntR-like transcriptional regulators 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_093198791.1.43806
Sequence length 253
Comment GntR family transcriptional regulator [Pseudomonas yamanorum]; AA=GCF_900105735.1; RF=na; TAX=515393; STAX=515393; NAME=Pseudomonas yamanorum; strain=LMG 27247; AL=Chromosome; RT=Major
Sequence
mpfqvidnqrlyrqiadqlralidsgefppgsrlpaerelakllgvsrasvreamialev
iglvdvrvgngvlvcepvlpkvsqepvmaqatrdqwkefdpelnlhvdfnaeippfsllq
arrliepeaaalaakhatdeelagireafernvqdnregshthpgdrlfhiriaqasgnp
ayalmiahllghrygsmfqrlqahytsddmphrsedehrkildaleqrdaegarqamrkh
leevvrifmrtaq
Download sequence
Identical sequences A0A1H2ELE8
gi|301629179|gb|XP_002943718| WP_093198791.1.43806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]