SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_093508484.1.66672 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_093508484.1.66672
Domain Number 1 Region: 171-374
Classification Level Classification E-value
Superfamily Lysozyme-like 2.76e-68
Family Family 19 glycosidase 0.00000891
Further Details:      
 
Domain Number 2 Region: 29-157
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.44e-41
Family Ricin B-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_093508484.1.66672
Sequence length 374
Comment chitinase [Streptomyces sp. Ag109_O5-10]; AA=GCF_900105755.1; RF=na; TAX=1855349; STAX=1855349; NAME=Streptomyces sp. Ag109_O5-10; strain=Ag109_O5-10; AL=Contig; RT=Major
Sequence
MPRRGRRVLGRPALGVVLAAVLSALFTVTPAQAATGQITGLAGKCLDVAGANSANGTAVQ
LYDCNGTGAQSWSNSGDGTLRALGKCLDVVDRGTADGAAVQLWDCSGGANQQWVVTAAHD
IVNPAANKCLDVRDNNSANGTRLQIWTCTGAANQKWNAPAGNGGGGNPSGFVVSEAQFNQ
MFPNRNGFYTYQGLTAALSAYPGFATTGSDTTRKQEAAAFLANVSHETGGLVYVVEQNTA
NYPTYCDWSQSYGCPAGQAAYYGRGPIQLSWNFNYKAAGDALGIDLLDNPWLVQNDSAVA
WKTGLWYWNTQSGPGTMTPHNAMVNGAGFGQTIRSINGSLECDGRNPAQVQSRVDAYQRF
TSILGVSPGANLYC
Download sequence
Identical sequences WP_093508484.1.66672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]