SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_093611539.1.2435 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_093611539.1.2435
Domain Number 1 Region: 172-401
Classification Level Classification E-value
Superfamily Lysozyme-like 1.27e-84
Family Chitosanase 0.0000000596
Further Details:      
 
Domain Number 2 Region: 38-156
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.75e-39
Family Ricin B-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_093611539.1.2435
Sequence length 402
Comment glycoside hydrolase [Actinoplanes philippinensis]; AA=GCF_900113015.1; RF=representative genome; TAX=35752; STAX=35752; NAME=Actinoplanes philippinensis; strain=DSM 43019; AL=Contig; RT=Major
Sequence
MIRVRTVAYAASGLVIAGTAIIVGLLPASAATAGPIKGLGGKCIDVAGAATANGTAVQLY
DCNNSAAQQWTVGNSDQTLRALGKCLDVTAASTADGAKIQLYDCNATGAQKWTASNGTLV
NTGSGKCLDATGNSSANGTRLQIWTCSTTANQQWTLPGGTTTPTTTPPAGGKNLDDPAKK
DVAMQIVSAAENSSLNWRAQFSYIEDINDGRGYTAGIIGFCSGTGDMLELVEAYTATKPS
NVLAKYLPALRSVNGTSSHSGLDPNFTKDWKTAAADPVFQAAQESERDRVYFNPSVRDGK
SDGVRALGQFAYYDASVVHGYEGMRSIRTRALKKAKPPAQGGDERTWLNAFLDERVVEMK
KEEAHSDVTRIDTAQRVFLNNGNFDLNTPLDFSVYGDPFHIG
Download sequence
Identical sequences A0A1I2CTB3
WP_093611539.1.2435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]