SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_094219305.1.26550 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_094219305.1.26550
Domain Number 1 Region: 170-373
Classification Level Classification E-value
Superfamily Lysozyme-like 1.6e-67
Family Family 19 glycosidase 0.00000979
Further Details:      
 
Domain Number 2 Region: 38-156
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.55e-40
Family Ricin B-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_094219305.1.26550
Sequence length 373
Comment chitinase [Streptomyces diastatochromogenes]; AA=GCF_002242805.1; RF=na; TAX=42236; STAX=42236; NAME=Streptomyces diastatochromogenes; strain=DSM 40608; AL=Scaffold; RT=Major
Sequence
MPTSSRRRSRFTIGFVLAAVLAALFTAAPAQAADGAITGLAGKCVDVAGAGSANGTAVQL
YDCNGTGAQIWSNPGDGTLRALGKCLDVVDRSTADGAAVQLWDCSGGANQQWQVTAAHDI
VNPAANKCLDVRDNNSANGTRLQIWSCSGGANQKWNAPASGGGGGTPSGFVVSEAQFNQM
FPNRNSFYTYSGLTAALSAYPGFTTTGSDTVRKQEAAAFLANVNHETGGLVYVVEQNTAN
YPHYCDWGQPYGCPAGQAAYYGRGPIQLSWNFNYKAAGDALGIDLLNNPWQVENNASVAW
KTGLWYWNTQSGPGSMTPHNAMVNGAGFGQTIRSINGSLECDGKNPAQVQSRVDAYQRFT
QILGVSPGNNLYC
Download sequence
Identical sequences A0A233S9Q4
WP_094219305.1.26550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]