SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001072524.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001072524.1.4139
Domain Number 1 Region: 94-274,320-337,1197-1313,1350-1372,1434-1607
Classification Level Classification E-value
Superfamily ARM repeat 0.000000972
Family Mo25 protein 0.08
Further Details:      
 
Weak hits

Sequence:  XP_001072524.1.4139
Domain Number - Region: 672-792
Classification Level Classification E-value
Superfamily Sec7 domain 0.0863
Family Sec7 domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001072524.1.4139
Sequence length 2170
Comment PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 3 isoform X2 [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MEEILRKLQRDASGSKYKAIKESCTWALETLGGLDTVAKIPPHLLREKCLLPLQLALESK
NVKLAQHALAGMQKLLSEERFVSMETDSDDKQLLNQILNAVKVTPSLNEDLQVEVMKVLL
CITYTPTFDMNGSAVLKIAEVCIETYTCSCHQRSINTAVRATLSQMLGDLTLQLRQRQEN
TIIENPDAPQGFRSQGLTVEALCDDVVSVLAVLCEKLQASINDSQQLQLLYLECILSILS
SSSSSMYLHRGFTDLIWKSLCPALVVILGNPIHDKTITSAHSTSTGTSMESDSASLGVSD
HGRGSGCSCTAPTLSGPVARTIYYLATELVRLVGSVDSLKPVLQSLYHRVLLYPPPQHRV
EAIKIMREILGSPQRLYDLAGPSSLESEPRKRSISKRKSHLDLLKLIMDGMTEACIKGGI
EACYAAVSCVCTLLGALDELSQGKGLNDNQVQQLLLRLEELRDGAESSRDSMEINEADFR
WQRKVLSSEHTPWETGNERSPDISISVTTDTGQTTLEGELGQTTPEDHKNGLKSPAIQEG
RETMSKVSEPETIDQPDVVQRSHTVPYPDITNFLSVDCRTRSYGSRYSESNFSVDDQDLS
RTEFDSCDQYSMAAEKDSGRSDVSDIGSDNCSLADEEQTPRDYMGHRSLRTAALSLKLLK
NQEADQHSARLFIQSLEGLLPRLLALSSVEEVDSALQNFASTFCSGMMHSPGFDGGSSLS
IQMLMNADSLYTAAHCALLLNLKLSHGDYYRKRPNVAPGMMKEFMKQVQTSGVLMVFSQA
WIEELFHQVLDRNMLGEAGYWGSPEDNNLPLITMLTDIDGLESSAIGGQLMASASMESPF
TQSRKLDDSTVAGIAFARYILVGCWKNLIDTLSTPLTGRMAGSSKGLAFILGAEGIKEQN
QKERDAICMSLDGLRKAARLSCALGVAANCASALAQMAAASCVQEEKEERESQEPSDALA
QVKLKVEQKLEQMGKAQGVWLHTAHVLCMDAILSVGLEMGSHNPDCWPHVFRVCEYVGTL
EHTHFSDGLSQPPLTIHQPQKTSGSSGLLGELEFKSSSQEQSLEQGPSLNAAPVVQPHTI
QELVRECSRGRTSDFRGGSLSGNSAAKVVLSLSTQADRLFDDATDKLNLTALGGFLYQLK
KASQSQLFHSVTDTVDYSLTMPGEVKSTQDQKSALHLYRLGDAMLRIVRSKARPLLHVMR
CWSLVAPHLVEAACHKERHVSQKAVSFIHDILTEVLTDWSEPPHFHFNEALFRPFERIMQ
LELCDEDVQDQVVTSIGELVEVCSAQIQSGWRPLFSALETVHSGNKSEVKEYLVGDYSMG
KGQAPVFDVFEAFLNTDNIQVFANAATSYIMCLMKFVKGLGEVDCKEIGDCVPGAGATST
DLCLPALDYLRRCSQLLAKIYKMPLKPIFLSGRLASLPRRLQEQSASSEDGIESVLSDFD
DDTGLIDVWIILLEQLTAAVSICPRQHQPPTLDLLFELLRDVTKTPGPGFGIYAVVHLLL
PVMSLWLRRSHKDHSYWDVASANFKHAIGLSCELVVEHIQSFLHSDIRYESMINTMLKDL
FELLVVCVAKPTETISRVGCSCIRYVLVTAGPVFTEEMWRLACCALQDAFSATLKPVKDL
LGCFHSGTEGFSGEGCQVRVAAPSSSPSAEAEYWRIRAMAQQVFMLDTQSSPKTPNNFDH
AQSCQLIIELPPDERPNGHAKKSVSFREIVVSLLSHQVLLQNLYDILLEEFVKGPSPGEE
KTVQAPDTKLAGFLRYISMQNLAVIFDLLLDSYRTAREFDTSPGLKCLLKKVSGIGGAAN
LYRQSAMSFNIYFHALVCAVLTNQETITAEQVKKVLFEEEERSSDSSQQCSSEDEDIFEE
TAQVSPPRGKEKRQWRARLPSLSVQPVSNADWVWLVKRLHKLCMELCNHYIQMHLDLESS
LEEPLAFKSDPFFILPSFQSESSTPSTGGFSGKNTPSEDDRREHLSEPLSLRVGSGDILM
LPPSPKTEKKDPGRKKEWWESAGNKIYTMAADKTISKLMTEYKKRRQPHNLPPFPKEVKV
DKKGEPLGPRGPDSPLLQRPQHLIDQGQMRHSFSAGPELLRQEKRPRSGSTGSSLSISVR
DAEAQIQAWTNMVLTVLNQIQILPDPTFTALQPAVFPCISQLTCHVTDIRVRQAVREWLG
RVGRVYDIIV
Download sequence
Identical sequences XP_001072524.1.4139 ENSRNOP00000015927 10116.ENSRNOP00000015927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]