SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001082641.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001082641.1.72884
Domain Number 1 Region: 145-251
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-24
Family Cadherin 0.00017
Further Details:      
 
Domain Number 2 Region: 252-367
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-22
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 474-577
Classification Level Classification E-value
Superfamily Cadherin-like 7.71e-21
Family Cadherin 0.0021
Further Details:      
 
Domain Number 4 Region: 368-480
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-19
Family Cadherin 0.0039
Further Details:      
 
Domain Number 5 Region: 80-152
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000286
Family Cadherin 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001082641.1.72884
Sequence length 785
Comment PREDICTED: cadherin-5 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MQRLMMLVATSGACLGLLAAAAAAAAAGANPAQRDTPSLLPTHRRQKRDWIWNQMHIDEE
KNTSLPHHVGKIKSSVSRKNAKYLLKGEFVDKVFRVDAETGDVFAIERLDRENISEYHLT
AVIVDKDTGENLETPSSFTIKVHDVNDNWPVFTHRLFNASVPESSAVGTSVISVTAVDAD
DPTVGDHASVMYQILKGKEYFAIDNSGRIVTITKSLDREKQARYEIVVEARDAQGLRGDS
GTATVLVTLQDINDNFPFFTQTKYTFVVPEDTRVGTSVGSLFVEDPDEPQNRMTKYSILR
GDYQDAFTIETNPTHNEGIIKPMKPLDYEYIQQYSFIVEATDPTIDLRYLSPPAGNRAQV
IINITDVDEPPIFQQPFYHFQLKENQKKPLIGTVLAMDPDAARHSIGYSIRRTSDKGQFF
RVTKKGDIYNEKELDREVYPWYNLTVEAKELDSTGTPTGKESIVQVHIEVLDENDNAPEF
AQPYQPKVCENAAHGQLVLQISAIDKDITPRNVKFKFTLNTENNFTLTDNHDNTANITVK
YGQFDREHTKVHFLPVVISDNGMPSRTGTSTLTVAVCKCNEQGEFTFCEDMAAQVGVSIQ
AVVAILLSILTITVIALLIFLRRRLRKQARAHGKSVPEIHEQLVTYDEEGGGEMDTTSYD
VSVLNSVRRGGAKPPRPALDARPSLYAQVQKPPRHAPGAHGGPGEMAAMIEVKKDEADHD
GDGPPYDTLHIYGYEGSESIAESLSSLGTDSSDSDVDYDFLNDWGPRFKMLAELYGSDPR
EELLY
Download sequence
Identical sequences A0A2K5TSK2 A0A2K6DVE4 F7DX07
9544.ENSMMUP00000030962 ENSMMUP00000030962 ENSMMUP00000030962 XP_001082641.1.72884 XP_005592195.1.63531 XP_011756269.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]