SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001082828.2.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001082828.2.72884
Domain Number 1 Region: 100-162
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.42e-17
Family LIM domain 0.0011
Further Details:      
 
Domain Number 2 Region: 281-344
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.9e-16
Family LIM domain 0.001
Further Details:      
 
Domain Number 3 Region: 223-284
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.04e-16
Family LIM domain 0.0016
Further Details:      
 
Domain Number 4 Region: 187-221
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000387
Family LIM domain 0.00044
Further Details:      
 
Domain Number 5 Region: 63-97
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000171
Family LIM domain 0.00091
Further Details:      
 
Domain Number 6 Region: 158-189
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000101
Family LIM domain 0.0009
Further Details:      
 
Weak hits

Sequence:  XP_001082828.2.72884
Domain Number - Region: 340-369
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0189
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001082828.2.72884
Sequence length 387
Comment PREDICTED: LIM and senescent cell antigen-like-containing domain protein 1 isoform X2 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MAFSGRARPCVIPENEEIPPAALNSVPEANGTEDERAVSKLQRRHSDVKVYKEFCDFYAK
FNMANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKY
CEHDFQMLFAPCCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLC
RPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKELTADARELKGE
LYCLPCHDKMGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLA
YCETHYNQLFGDVCFHCNRVIEGDVVSALNKAWCVNCFACSTCNTKLTLKNKFVEFDMKP
VCKKCYEKFPLELKKRLKKLAETLGRK
Download sequence
Identical sequences F7HRP5 G7PMX1
XP_001082828.2.72884 XP_005575273.1.63531 ENSMMUP00000012005 ENSMMUP00000036177 9544.ENSMMUP00000012005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]