SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001083960.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001083960.1.72884
Domain Number 1 Region: 65-351
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.77e-101
Family GatB/GatE catalytic domain-like 0.000000389
Further Details:      
 
Domain Number 2 Region: 375-480
Classification Level Classification E-value
Superfamily GatB/YqeY motif 7.43e-26
Family GatB/GatE C-terminal domain-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001083960.1.72884
Sequence length 557
Comment PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial isoform X1 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MAAPMLRWVGRGRLWTFARVDGGSCHRREAPTGSTSNWIRGQSSVAQQPLYMTQKPRKGE
HKWAAVVGLEIHAQISSNSKLFSGSQVRFSAPPNSLVSFFDASLPGTLPVLNRRCVEAAV
MTGLALNCHINKKSLFDRKHYFYADLPAGYQITQQRLPIAVNGSLTYGVCAGKKQSQVIP
KTVRIKQIQLEQDSGKSLHDDLRSQTLIDLNRAGVGLLEVVLEPDLSCGEEAATAVRELQ
LILQALGTSQANMAEGQLRVDANISVHHPGEPLGVRTEVKNLNSIRFLAKAIDYEIQRQI
NELENGGEILNETRSFHYQLGCTMSMRDKEGKQDYRFMPEPNLPPLVLYDATSLPAGADP
QQVINIDQIRETLPELPSVTRERLVQQYGMLLEHSFTLLNEVGLLEFFQNVIKETRAEPK
KVTSWVLNTFLGYLKQQNLAVSESPVTPSALAELLDLLDSRTISSAAAKQVFEELWKREG
KTPGQIVSEKQLELMEDRGALEQLCHSMMEAHPQVVMDLKKGNPRAINKLIGLVRKATQS
RADPAMIKEILEKKLSS
Download sequence
Identical sequences F7GP33
9544.ENSMMUP00000014466 ENSMMUP00000014466 XP_001083960.1.72884 ENSMMUP00000014466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]