SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001090479.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001090479.1.72884
Domain Number 1 Region: 235-333
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.78e-31
Family Thioltransferase 0.00000961
Further Details:      
 
Domain Number 2 Region: 136-231
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.67e-28
Family Thioltransferase 0.0000977
Further Details:      
 
Domain Number 3 Region: 14-115
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.86e-27
Family Thioltransferase 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001090479.1.72884
Sequence length 335
Comment PREDICTED: glutaredoxin-3 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MAAGAAEAAVAALEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKEH
PQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGS
FPPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFD
IFSDEEVRQGLKAYSNWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLK
VLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWP
TYPQLYVKGELVGGLDIVKELKENGELLPILRGEN
Download sequence
Identical sequences A0A096NSU9 A0A0D9QWM0 A0A2K5IT19 A0A2K5KIR4 A0A2K5U780
XP_001090479.1.72884 XP_005566812.1.63531 XP_011797347.1.43180 XP_011797348.1.43180 XP_011946666.1.92194 ENSMMUP00000024249 9544.ENSMMUP00000024249 ENSMMUP00000024249 ENSPANP00000016120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]