SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001090814.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001090814.1.72884
Domain Number 1 Region: 230-360
Classification Level Classification E-value
Superfamily Cadherin-like 5.5e-29
Family Cadherin 0.0012
Further Details:      
 
Domain Number 2 Region: 439-571
Classification Level Classification E-value
Superfamily Cadherin-like 1.33e-28
Family Cadherin 0.00096
Further Details:      
 
Domain Number 3 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 1.26e-23
Family Cadherin 0.0047
Further Details:      
 
Domain Number 4 Region: 340-444
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-20
Family Cadherin 0.0074
Further Details:      
 
Domain Number 5 Region: 555-664
Classification Level Classification E-value
Superfamily Cadherin-like 7.59e-17
Family Cadherin 0.0037
Further Details:      
 
Domain Number 6 Region: 30-95
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000108
Family Cadherin 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001090814.1.72884
Sequence length 796
Comment PREDICTED: protocadherin beta-3 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MEAGGERFLRQRQVLLLFVFLGGSLAGSESRRYSVAEEKEKGFLIANLAKDLGLRVEELA
ARGAQVVSKGNKQHFQLSHQTGDLLLNEKLDREELCGPTEPCILHFQILLQNPLQFVTNE
LHIIDVNDHSPVFFENEMHLKILESTLPGAVIPLGNAEDLDVGRNSLQNYTITPNSHFHV
LTRSRRDGRKYPELVLDKALDREEQPELSLTLTALDGGAPPRSGTAQINIQVLDINDNAP
EFAQPLYEVAVLENTPVNSVIVTVSASDLDTGSFGTISYAFFHASEEIRKTFQLNPITGD
MQLVKYLNFEAINSYEVDIEAKDGGGLSGKSTVIVQVVDVNDNPPELTLSSVNSPIPENS
AETVLAVFSVSDLDSGDNGRVVCSIENNLPFILKPSVENFYTLMSEGALDRETRSEYNIT
ITVTDLGTPRLKTKYNITVLVSDVNDNAPAFTQTSYTLFVRENNSPALHIGSVSATDRDS
GTNALVTYSLLPPQDPHLPLAPLVSINADNGHLFALRSLDYEALQAFEFRVGATDRGSPA
LSSEALVRVLVLDANDNSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNA
WLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDAAKHRLVVLVKDNGEPPRSATATLHL
LLVDGFSQPYLPLPEAAPAQAQADSLTVYLVVALASVSLLFLLSVLLFVAVRLCRRSRAA
SVGRCSVPEGPFPGHLVDVSGTETLSQSYQYEVCLTGGSGTNEFKFLKPIIPNFVAQGAE
RVSEANPSFRKSFEFS
Download sequence
Identical sequences XP_001090814.1.72884 ENSMMUP00000019139 ENSMMUP00000019139 9544.ENSMMUP00000019139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]