SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001090927.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001090927.1.72884
Domain Number 1 Region: 229-360
Classification Level Classification E-value
Superfamily Cadherin-like 2.22e-30
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 438-570
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-28
Family Cadherin 0.0012
Further Details:      
 
Domain Number 3 Region: 126-233
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-25
Family Cadherin 0.0036
Further Details:      
 
Domain Number 4 Region: 339-443
Classification Level Classification E-value
Superfamily Cadherin-like 1.02e-21
Family Cadherin 0.006
Further Details:      
 
Domain Number 5 Region: 554-663
Classification Level Classification E-value
Superfamily Cadherin-like 9.42e-18
Family Cadherin 0.002
Further Details:      
 
Domain Number 6 Region: 28-95
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000971
Family Cadherin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001090927.1.72884
Sequence length 795
Comment PREDICTED: protocadherin beta-4 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MKKLGRIHPNRQVLAFILMVILSQVHLEPIRYSVLEETESGSFVAHLTKDLGLGIAELAA
RSAGVVSDDDKQRLQLDRQTGDLFLREKLDREELCGPIEPCILHFQVFLEMPVQFFQGEL
LIQDINDHSPVFPEREVLLKIPENSQPGTLFPLLIAEDLDVGSNGLQKYTISPNSHFHIL
TRNHSEGKKYPDLVQDKPLDREEQSEFSLTLVALDGGSPPRSGTVMVRILIMDINDNAPE
FVHTPYGVQVLENSPLDSPIVRVLARDVDAGNFGSVSYGLFQASDEIKQTFSINEVTGEI
LLKKKLDFEKIKSYHVEIEATDGGGLSGKGTVVIEVVDVNDNPPELIISSLTSSIPENAP
ETVVSIFRIRDRDSGENGKTICSIPDNLPFVLKPTLKNFYTLVTERPLDRETRAEYNITI
TVTDLGTPRLKTQQSITVQVSDVNDNAPTFTQTSYTLFVRENNSPALHIGSVSATDRDSG
TNAQVTYLLLPPQDPHLPLASLVSINADNGHLFALRSLDYEALQGFEFRVGAADRGSPAL
SSEALVRVLVLDANDNSPFVLHPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAW
LSYQLLKATEPGLFGVWAHNGEVRTARLLSERDAAKHRLVVLVKDNGEPPRSATATLHVL
LVDGFSQPYLPLPEAALAQAQNDSLTIYLVVALASVSSLFLLSVLLFVAVRLCRRSRAAS
VGRCSVPEGPFPGHQVGVSGTETLSQSYQYEVCLTGDSGTGEFKFLKPIFPNLLVQDTRR
EVKENPNFRNSFVFS
Download sequence
Identical sequences 9544.ENSMMUP00000019142 ENSMMUP00000019142 ENSMMUP00000019142 XP_001090927.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]