SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001092640.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001092640.1.72884
Domain Number 1 Region: 8-71
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000288
Family HLH, helix-loop-helix DNA-binding domain 0.0052
Further Details:      
 
Domain Number 2 Region: 80-123
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000209
Family Hairy Orange domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001092640.1.72884
Sequence length 173
Comment PREDICTED: transcription factor HES-2 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MGLPRRAGDAAELRKSLKPLLEKRRRARINQSLSQLKGLILPLLGRENSNCSKLEKADVL
EMTVRFLQELPALSWPTAAPVPCDSYREGYSACVARLARVLPACRVLEPAVSARLLEHLW
RRAASATLDGGRAGDSGGPSAPAPTPASAPQPASVPVPSPPSPPCGPGLWRPW
Download sequence
Identical sequences A0A1D5R8B9 A0A2K5UY12
ENSMMUP00000030134 XP_001092640.1.72884 XP_005544981.1.63531 9544.ENSMMUP00000030134 ENSMMUP00000030134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]