SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001092850.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001092850.1.72884
Domain Number 1 Region: 26-127
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000863
Family Dystroglycan, N-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001092850.1.72884
Sequence length 387
Comment PREDICTED: alpha-sarcoglycan isoform X1 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MAVTLFWTPLLVVLLAGLGDCEAQQTTLYPLVGRVFVHTLDHETFLSLPEHVAVPPAVHI
TYHAHLQGHPDLPRWLRYTQRSPHHPGFLYGSATPEDRGRQVIEVTAYNRDSFDTTQQRL
VLEIGDSEGPLLPYQAEFLVRSHDVEEVLPSAPASRFLSALGGLWEPGELQLLNITSALD
RGGRVPLPIEGRKEGVYIKVGSASPFSTCLKMVASPDSHARCAQGQPPLLSCYDTLAPHF
RIDWCNVTLVDKSVPEPADEMPTPGDGILEHDPFFCPPTEAPDRDFLVDALVTLLVPLLV
ALLLTLLLAYVMCCRREGRLKRDLATSDIQMVHHCTIHGNTEELRQMAANREVPRPLSTL
PMFNVRTGERLPPRVDSAQVPLILDQH
Download sequence
Identical sequences F7H4B7 G7PUA0
ENSMMUP00000034893 ENSMMUP00000001953 XP_001092850.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]