SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001094038.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001094038.1.72884
Domain Number 1 Region: 430-709
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000229
Family Rhodopsin-like 0.017
Further Details:      
 
Weak hits

Sequence:  XP_001094038.1.72884
Domain Number - Region: 50-76
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0167
Family Integrin beta EGF-like domains 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001094038.1.72884
Sequence length 796
Comment PREDICTED: adhesion G-protein coupled receptor G7 isoform X1 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MASCRAWNIRVLVAVVCGLLTGIILGLGIWRIVIRIQRGISATSSSTPTEFCRNGGTWEN
GRCVCTEEWKGLRCTIANFCEKSTYMGFTFARIPVGRYGPSLQTCGKGTPNAGNPMAVRL
CNLSPYGEIELQNVTIGNCNENLETLEEQVKDVTAPLNNISSEVQILTSDANKLTAENIS
SATRVVGQIFNTSRNASPEAKKIAIVTVSQLLDASGDAFQEAAATANNDALTTLIEQMET
YSLSLGNESVVEPNIAIQSANFSSKDAVGPLNVRFSVQKGASSSLLSGSTFIHTNVDGLN
PDGQTELQVLLNMTKSNSKACGFVVYQNDKLFQSKTFTAKSNFSQKIISSKTDENEQDQS
ASVDMVFSPRYNQREFQLYSYACVYWNLSTRDWDTYGCQKHKGTDGFLRCHCNHTTNFAV
LMTFKKDYQYPESLDVFSNVGCALSITGLALTIVFQIVTRKVRKTSVTWVLVNLCISMLI
FNLLFVFGIENSNKNKTSDGDIHDIDFKNNDVPQTDTINIPNPTCTAIAALLHYFLLVTF
TWSALNAAQLYFLLIRTMKPLPRHFILFISLIGWGVPAIVVAITVGVIYSQNGKNPQWEL
DYRQETICWLAIPEPDGVIKSPLLWSFIVPVTIILISNVVIFITISIKVLWKNNQNLTST
KKVSSMRKIVSTLSVAVVFGITWILAYLMLVNDDSIRIIFSYIFCLFNTTQGLQIFFLHT
VRTKIFQTEASKVLTLLSSIGGKKSLSSVTRLRLRIRMYNFLRSLPTLHEHFRLLETSPS
TEDITLSESDKAKQSI
Download sequence
Identical sequences 9544.ENSMMUP00000003826 XP_001094038.1.72884 ENSMMUP00000003826 ENSMMUP00000003826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]