SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001094774.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001094774.1.72884
Domain Number 1 Region: 80-310
Classification Level Classification E-value
Superfamily Kelch motif 5.1e-46
Family Kelch motif 0.0036
Further Details:      
 
Domain Number 2 Region: 281-382
Classification Level Classification E-value
Superfamily NHL repeat 0.0000915
Family NHL repeat 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001094774.1.72884
Sequence length 442
Comment PREDICTED: kelch domain-containing protein 10 isoform X2 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MSAAQGWDRNRRRGGGAAGAGGGGSGAGGGSGGSGGRGTGQLNRFVQLSGRPHLPGKKKI
RWDPVRRRFIQSCPIIRIPNRFLRGHRPPPARSGHRCVADNTNLYVFGGYNPDYDESGGP
DNEDYPLFRELWRYHFATGVWHQMGTDGYMPRELASMSLVLHGNNLLVFGGTGIPFGESN
GNDVHVCNVKYKRWALLSCRGKKPSRIYGQAMAIINGSLYVFGGTTGYIYSTDLHKLDLN
TREWTQLKPNNLSCDLPEERYRHEIAHDGQRIYILGGGTSWTAYSLNKIHAYNLETNAWE
EIATKPHEKIGFPAARRCHSCVQIKNDVFICGGYNGEVILGDIWKLNLQTFQWVKLPATM
PEPVYFHCAAVTPAGCMYIHGGVVNIHENKRTGSLFKIWLVVPSLLELAWEKLLAAFPNL
ANLSRTQLLHLGLTQGLIERLK
Download sequence
Identical sequences A0A096MX45 A0A2K5F5B0 A0A2K5P711 A0A2K5PG61 A0A2K5VV65 A0A2K6EC51 A0A2K6KH07 A0A2K6P805 F6SHC5 G1RQC7 G3QEH2 H2PNI2 H2QVD2 Q6PID8
ENSCJAP00000019489 ENSCJAP00000019489 ENSNLEP00000015441 ENSMMUP00000012214 ENSMMUP00000012213 ENSNLEP00000015441 ENSPPYP00000020195 ENSGGOP00000000666 ENSGGOP00000000666 ENSGGOP00000019579 ENSPPYP00000020195 NP_055812.1.87134 NP_055812.1.92137 XP_001094774.1.72884 XP_002752056.1.60252 XP_002818490.1.23681 XP_003261375.1.23891 XP_004046259.1.27298 XP_005550816.1.63531 XP_007981096.1.81039 XP_010377082.1.97406 XP_011722173.1.29376 XP_011943442.1.92194 XP_012329500.1.9421 XP_017388050.1.71028 XP_017730543.1.44346 XP_519376.2.37143 9544.ENSMMUP00000012214 9598.ENSPTRP00000033724 9600.ENSPPYP00000020195 9606.ENSP00000334140 ENSPTRP00000033724 ENSP00000334140 ENSP00000334140 gi|44917619|ref|NP_055812.1| ENSPTRP00000033724 ENSP00000334140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]