SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001095005.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001095005.1.72884
Domain Number 1 Region: 3-159
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.74e-25
Family Canonical RBD 0.0000152
Further Details:      
 
Domain Number 2 Region: 373-459
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.45e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 3 Region: 273-348
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.61e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 4 Region: 192-269
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 5 Region: 468-547
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.21e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001095005.1.72884
Sequence length 556
Comment PREDICTED: insulin-like growth factor 2 mRNA-binding protein 2 isoform X2 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSG
KVELHGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTET
AVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQG
HAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEK
PVTIHATPEGTSEACRMILEIMQKEADETKLAEEIPLKILAHNGLVGRLIGKEGRNLKKI
EHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIMKKLREAFENDMLAVNTHS
GYFSSLYPHHQFGPFPHHHSYPEQEVVNLFIPTQAVGAIIGKKGAHIKQLARFAGASIKI
APAEGPDVSERMVIITGPPEAQFKAQGRIFGKLKEENFFNPKEEVKLEAHIRVPSSTAGR
VIGKGGKTVNELQNLTSAEVIVPRDQTPDENEEVIVRIIGHFFASQTAQRKIREIVQQVK
QQEQKYPQGVASQRSK
Download sequence
Identical sequences A0A2I3LGX2 A0A2K5HDT8 A0A2K5ML42 A0A2K5X518
XP_001095005.1.72884 XP_005546656.1.63531 XP_011808768.1.43180 XP_011889774.1.92194 ENSMMUP00000030831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]