SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001095121.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001095121.1.72884
Domain Number 1 Region: 29-217,317-413
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.74e-46
Family Bacterial dinuclear zinc exopeptidases 0.0046
Further Details:      
 
Domain Number 2 Region: 206-308
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 1.09e-21
Family Bacterial exopeptidase dimerisation domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001095121.1.72884
Sequence length 436
Comment PREDICTED: peptidase M20 domain-containing protein 2 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MRPGVERSVEGGAYDGSSELELLKLRAAECIDKAAERLGALSRAIWSQPELAYEEHHAHR
VLTHFFEREPPAASWAVQPHYQLPTAFRAEWEPPEARAPSAAPRPLHLGFLCEYDALPGI
GHACGHNLIAEVGAAAALGVRGALEGLPRPPPPVKVIVLGTPAEEDGGGKIDLIEAGAFT
NLDVVFMAHPSQENAAYLPDMAEHDVTVKYYGKASHSAAYPWEGLNALDAAVLAYNNLSV
FRQQMKPTWRVHGIIKNGGVKPNIIPSYSELIYYFRAPSMKELQVLTKKAEDCFRAAALA
SGCTVEIKSGAHDYYNVLPNKSLWKAYMENGRKLGIEFISEDKMLNGPSGSTDFGNVTFV
VPGIHPYFHIGSNALNHTEQYTEAAGSQEAQFYTLRTAKALAMTALDVIFKPELLERIRE
DFKLKLQEEQFVNAVE
Download sequence
Identical sequences A0A2K5UGH7 F6TN77
ENSMMUP00000019599 ENSMMUP00000019599 9544.ENSMMUP00000019599 XP_001095121.1.72884 XP_005552436.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]