SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001096505.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001096505.1.72884
Domain Number 1 Region: 37-97
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000721
Family Ovomucoid domain III-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001096505.1.72884
Sequence length 97
Comment PREDICTED: serine protease inhibitor Kazal-type 14 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MARSFPLVSLLPFVLIHLVLSSVSGPRHWWPPHGIIKVKCPYEKVNLSWYNGTVNPCPGL
YQPICGTNFITYDNPRILCVESLKSHGRIRFYHDGKC
Download sequence
Identical sequences XP_001096505.1.72884 ENSMMUP00000001601 9544.ENSMMUP00000001601 ENSMMUP00000001601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]