SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001096863.2.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001096863.2.72884
Domain Number 1 Region: 347-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.17e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 3-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 459-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.54e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 402-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 500-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.13e-22
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 180-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.64e-17
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 7 Region: 142-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000786
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 8 Region: 223-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000474
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 9 Region: 290-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000002
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001096863.2.72884
Sequence length 557
Comment PREDICTED: zinc finger protein 195 isoform X4 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MTLLTFRDVAIEFSLEEWKCLDPAQQNLYRDVMLENYRNLFSIGLTVSKPGLITCLEQRK
EPWNVKRQEAVDGRPAMSSHVTQDLLPEQGIQDAFPKSILRGYGNCGLDNLHLRKDWESL
NECKLQKDYNELNQCSSTTHSKIFQCNKYVKIFNNFSNLHRHNISNTGEKPFKCQECGKS
FQMFSFLTEHQKIHTGKKFQKCGECGKTFIQCSHFTEHENIDTGEKPYRCQECDKVFKTC
SVLTKNRIYAGGEHYKCEEFGKVFNQYSHLTEHERGTEEKPCKYEECSSVFISCSSLSNQ
QLILAGEKLSKCETWYRGFNHSPNPSKHQRNEIGGKPFKCEECDSIFKWFSDLTKHKRIH
TGEKPYKCEECGKAYTQSSHLSEHRRIHTGEKPYQCEECGKVFRTCSSLSNHKRTHSEEK
PYTCEECGNIFKQLSDLTKHKKTHTGEKPYKCDECGKNFTQSSNLIVHKRIHTGEKPYKC
EECGRVFMWFSDITKHKKTHTGEKPYKCDECGKNFTQSSNLIVHKRIHTGEKPYKCEKCG
KAFTQFSHLTVHESIHT
Download sequence
Identical sequences A0A1D5RDU3
ENSMMUP00000029136 XP_001096863.2.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]