SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001097704.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001097704.1.72884
Domain Number 1 Region: 16-114,163-291,319-439,539-644
Classification Level Classification E-value
Superfamily MFS general substrate transporter 5.89e-36
Family Glycerol-3-phosphate transporter 0.068
Further Details:      
 
Domain Number 2 Region: 457-506
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000305
Family Ovomucoid domain III-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001097704.1.72884
Sequence length 691
Comment PREDICTED: solute carrier organic anion transporter family member 1B1 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MDQNKHLDKTAEAQSSENKKTRHCNGLKMFLAALALSFIAKALGAVVMKSSIIHIERRFE
ISSSLVGFIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCFIMGIGGVLTALPHFFMGY
YRYSKEINIDSSENSTSTLSTCLINQIVSLNRTSPEIVGKGCVKESGSYMWMYVFMGNML
RGIGETPIVPLGLSYMDDFAKEGHSSLYLGILNAIAMIGPIIGFTLGSLFSKMYVDIGSV
DLSTVRITPNDSRWVGAWWLNFLVSGLFSIISSIPFFFLPQTPNKPQKERKASLSLPVLE
TNDGKSQTANLTSRGKKITKNVTGFFRSFKSILTNPLYVVFVLLTLLQISSYIGGFTYVF
KYVEQEYGQPSSKTNVLLGIVTLPIFASGMFLGGYIIKKFKLNPIGIAKFSFFTTVMSLF
FYLLYFFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPVCGNNGIT
YISPCLAGCKSSSGNKKSIVFHNCSCLEVTGLQNRNYSAHLGECPRSDACLTKFYFFVAI
QVLNLFFSALGGTSYFMLMVKIVQPELKSLALGFHSMVIRALGGILAPIYFGALIDTTCM
KWSTNNCGTRGSCRIYNSTLFSKVYLGLSSVLRVSSLVLYIILIYAMKKKFQEKDANASE
NGSVMDEANLESLNNNKHFVPSAGADSETHY
Download sequence
Identical sequences F6UHW9
XP_001097704.1.72884 9544.ENSMMUP00000011258 ENSMMUP00000011258 ENSMMUP00000011258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]