SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001098032.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001098032.1.72884
Domain Number 1 Region: 46-198
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.16e-47
Family Glutathione peroxidase-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001098032.1.72884
Sequence length 209
Comment PREDICTED: probable glutathione peroxidase 8 isoform X1 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MEPLAAYPLKCSGPRAKVFAVLLSMVLCTVTLFLLQLKFLKPKINSFYAFEVKDAKGRTV
SLEKYKGKVSLVVNVASDCQLTDRNYLALKELHKEFGPSHFSVLAFPCNQFGESEPRPSK
EVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKF
WRPEEPIDVIRPDIAALVRKLIIKKKEDL
Download sequence
Identical sequences F7GUZ8
9544.ENSMMUP00000002145 XP_001098032.1.72884 ENSMMUP00000002145 ENSMMUP00000002145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]