SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001098382.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_001098382.1.72884
Domain Number - Region: 308-422
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000748
Family APC10-like 0.076
Further Details:      
 
Domain Number - Region: 193-224
Classification Level Classification E-value
Superfamily MPN010-like 0.0497
Family MPN010-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001098382.1.72884
Sequence length 438
Comment PREDICTED: sperm-associated antigen 4 protein isoform X1 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MRRSSRPGSASSSRKHTPNFFSENSSVSITSEDSNGLRSAGPGPGDPEGRGARGPSCGEP
ALSAGVPGGTTWAGSSRQKPAPRSHNWQPACGAATVRGGASEPTGSPAVSEEPLDLLPTL
DLRQEMPPSRVFKSFLSLLFQVLSVLLSLAGDVLVSMYREVCSIRFLFTAVSLLSLFLAA
IWLGLLYLVSPLENEPKEMLTLSEYHERVRSQGQQLQQLQAELDKLHKEVSTVRAANSER
VAKLVFQRLNEDFVRKPDYALSSVGASIDLQKTSHDYADRNTAYFWNRFSFWNYARPPTV
ILEPHVFPGNCWAFEGDQGQVVIQLPGRVQLSDITLQHPPPSVEHTGGANSAPRDFAVFG
LQVDDETEVFLGKFTFDVEKSEIQTFHLQNDPPAAFPKVKIQILSNWGHPRFTCLYRVRA
HGVRTSEGAEGSATGGPH
Download sequence
Identical sequences XP_001098382.1.72884 9544.ENSMMUP00000027580 ENSMMUP00000027580 ENSMMUP00000027580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]