SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001098570.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001098570.1.72884
Domain Number 1 Region: 3-246
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.59e-53
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0046
Further Details:      
 
Domain Number 2 Region: 310-484
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000035
Family FAD/NAD-linked reductases, N-terminal and central domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001098570.1.72884
Sequence length 558
Comment PREDICTED: dimethylaniline monooxygenase [N-oxide-forming] 4 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MAKKVAVIGAGVSGISSIKCCVDEDLEPTCFERSDDIGGLWKFTESSKDGMTRVYKSLVT
NVCKEMSCYSDFPFHEDYPNFMNQEKFWDYLQEFAEHFDLLKYIQFKTTVCSITKRPDFS
ETGQWDVVTETEGKQNRAVFDAVMVCTGHFLNPHLPLEAFPGIHKFKGQILHSQEYKIPE
GFQGKRILVIGLGNTGGDIAVELSRTAAQVLLSTRTGTWVLGRSEDWGYPFNMMVIRRYY
SFIAQVLPSRFLNWIQERKLNKRFNHEDYGLSITKGKTAKFIVNDELPNCILCGTITMKT
SVMEFTETSAVFEDGTVEENIDVVIFTTGYTFSFPFFEEPLKSLCTKKIFLYKHVFPLNL
ERATLAIIGLLSLKGSILSATELQARWATRVFKGLCKIPPSQKLMMEATEKEQLIKRGVI
KDTNKDKLDYIAYMDDIAACIGTKPSIPLLFLKDPRLAWEVFFGPCTPYQYRLVGPGKWD
GARNAILTQWDRTLKPLKTRIVPDSSKPASMSHYLKAWGAPVLLASLLLICKSSLFLKLV
RDKLQNRMSPYLVSLWRG
Download sequence
Identical sequences F7D7C4
ENSMMUP00000018690 XP_001098570.1.72884 XP_014979790.1.72884 ENSMMUP00000018690 9544.ENSMMUP00000018690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]