SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001098597.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001098597.1.72884
Domain Number 1 Region: 147-285
Classification Level Classification E-value
Superfamily Cadherin-like 1.18e-25
Family Cadherin 0.00029
Further Details:      
 
Domain Number 2 Region: 387-499
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000328
Family Cadherin 0.0076
Further Details:      
 
Domain Number 3 Region: 265-359
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000171
Family Cadherin 0.00058
Further Details:      
 
Domain Number 4 Region: 82-159
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000012
Family Cadherin 0.0011
Further Details:      
 
Domain Number 5 Region: 505-593
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000392
Family Cadherin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001098597.1.72884
Sequence length 1118
Comment PREDICTED: desmoglein-2 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MARSPGRAYALLLLLICFNVGSGLYLQVSSTRNENKLLPKHPHLVRQKRAWITAPVALRE
GEDLSKKNPIAKIHSDLTEERGLKVTYKYTGKGITEPPFGIFVFNKDTGELNITSILDRE
ETPFFLLTGYALDERGNNVEKPLELRIKVLDINDNEPVFTQDVFVGSVEELSAAHTLVMK
INATDADEPNTLNSKISYRIVSLEPAYPPVFYLNKDTGEIYTTSVTLDREEHSSYTLTVE
ARDGNGEVTDKPVKQAQVQIRILDVNDNIPVVENKVLEGMVEENQVNVEVTRIKVFDADE
IGSDNWLANFTFASGNEGGYFHIETDAQTNEGIVTLIKEVDYEEMKNLDFSVIVTNKAAF
HKSIRSKYKPTPIPIKVKVKNVKEGIHFKSSVISTYVSESMDKSSKGQIIGKFQAFDEDT
GLLARARYVKLEDRDNWISLDSVTSEIKLAKLPDFESRYVQNGTYTVKIVAISEDYPRKT
ITGTVLIYVEDINDNCPTLIEPVQTICNDAQYVNVTAEDLDGHPNSGPFSFSVIDKPPGM
AEKWKIVHQESTSVLLQQSEKKLGRSEIQFLISDNQGFSCPEKQMLTLTVCECLHGSGCR
EAQRDSYVGLGPAAIALMILAFLLLLLVPLLLLMCHCGKGGKGFTPIPGTIEMLHPWNNE
GAPPEDKVVPSFLPVDQGESLGGRNGVGGMAKEATMKGSSSASFAKGQHEMSEMDGRWEE
YRSLLSGRATQVTGATGAIMTTETTKTTRATGASRDMAGAQAAAVALNEEFLRNYFSDKA
ASYTEEDENHTAKDCLLVYSQEETESLNASIGCCSFIEGELDDRFLDDLGLKFKTLAEVC
LGQKIDINMEIEQRQKPATETSMNTASRSAYEQTMVNSENTYSSGSSFPVPKSLQEANAE
KVTQEIVTERSVSSRQAQKVATPLPDPVASRNIIATETSYVTGSTMPPSTVILGPRQPQS
LIVTERVYAPASALVDQPYANEGTVVVTERVIQPHGGGSNPLEGTQHLQDAPYVMVRERE
SFLAPSSGVQPTLAMPNITVGQNVTVTERVLAPASTLQSSYQIPTENSVKARNTMVSGAG
VPGPLPDFGLEESGHSNSTITTSSTRVTKHSTVQHSYS
Download sequence
Identical sequences A0A1D5Q0F3
9544.ENSMMUP00000027766 XP_001098597.1.72884 ENSMMUP00000027766 ENSMMUP00000027766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]