SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001099911.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001099911.1.72884
Domain Number 1 Region: 3-141
Classification Level Classification E-value
Superfamily ENTH/VHS domain 4.36e-53
Family ENTH domain 0.00000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001099911.1.72884
Sequence length 608
Comment PREDICTED: ENTH domain-containing protein 1 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MAFRRQVKNFVKNYSDAEIKVREATSNDPWGPSSSLMLDISDLTFNTISLSEIMNMLWHR
LNDHGKNWRHVYKSLTLMDYLIKNGSKKVVQHCREGFCNLQTLKDFQHIDEAGKDQGYYV
REKSKQVITLLMDEQLLCKEREVACRTRQRTSYSMLFSKRPLGSSSSLTARTSAPTSDIS
ASEKKCKLPKFGRLRNKKNVCKAELKQEHCQDLHLPTETMLSQETLPLKIHGWKSTEDLM
TFSDDDPKLPLLATPPSIVSPITCLSEAAEVCNLLGADAVPTVSENSPSGQTDVSLDKRS
DGTLTNTVTENLLETPLEKQSAAEGLKTLTILPACWSSSKEEFISPNLRISKSNSTFHNQ
ASVETLYLSPSFKIFDPAKETVINKACQKPPQSSIQMDDKILKTTTWVSTASEGASSFSP
LSMSSPDLASPEKSAHLLSPILAGPSFWTLSHQQLSSTSFKEEDKTTKLHHSFASRGPVS
SDAEENDSLNLLGILPNNSDSAKKNVSHISSRHWGEFSTQNVDQFIPLSCSGFQSTKDFP
REPEAENSISVLLREVKCAIARLHEDLSTVIQELNVINNHLMSMSLNSSQISQSSQAPQS
SEGSSDQI
Download sequence
Identical sequences F7AN62 G7PFL3
9544.ENSMMUP00000006486 XP_001099911.1.72884 ENSMMUP00000006486 ENSMMUP00000006486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]