SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001100497.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001100497.1.72884
Domain Number 1 Region: 8-73
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000344
Family LIM domain 0.0099
Further Details:      
 
Domain Number 2 Region: 189-255
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000542
Family LIM domain 0.0025
Further Details:      
 
Domain Number 3 Region: 68-133
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000105
Family LIM domain 0.0071
Further Details:      
 
Domain Number 4 Region: 130-192
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000698
Family LIM domain 0.0078
Further Details:      
 
Domain Number 5 Region: 251-278
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000106
Family LIM domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001100497.1.72884
Sequence length 284
Comment PREDICTED: four and a half LIM domains protein 5 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MTTAQFYCQYCTASLLGKKYVLKDDSLFCVTCYDRVFSNYCEECKKPIESDSKDLCYKDR
HWHEGCFKCTKCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIMPGSRKMEFKG
NYWHETCFVCENCRQPIGTKPLISKESGNFCVPCFEKEFAHYCNFCKKVITSGGITFCDQ
LWHKECFLCSGCRKDLCEEQFMSRDDYPFCVDCYNHLYANKCVACSKPISGLTGAKFICF
QDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKCGSGMDSDI
Download sequence
Identical sequences F7F0V6 G7P427
ENSMMUP00000016576 ENSMMUP00000033333 ENSMMUP00000016576 NP_001270282.1.63531 XP_001100497.1.72884 XP_001100593.1.72884 XP_005552380.1.63531 XP_014992449.1.72884 XP_014992450.1.72884 9544.ENSMMUP00000016576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]