SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001101289.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001101289.1.72884
Domain Number 1 Region: 134-273
Classification Level Classification E-value
Superfamily ISP domain 2.62e-40
Family Rieske iron-sulfur protein (ISP) 0.000000764
Further Details:      
 
Domain Number 2 Region: 79-147
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 2.4e-23
Family ISP transmembrane anchor 0.0000304
Further Details:      
 
Domain Number 3 Region: 1-57
Classification Level Classification E-value
Superfamily Non-globular alpha+beta subunits of globular proteins 1.6e-19
Family Ubiquinol-cytochrome c reductase 8 kDa protein 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001101289.1.72884
Sequence length 274
Comment PREDICTED: cytochrome b-c1 complex subunit Rieske, mitochondrial [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MLSVAARSGPFAPVLSATSRGVAGALRPLVQATVPATPKPPVLDLKRPFLSRESLSGQAV
RRPLVASVGLNVPASVCYSHTDVKVPDFYDYRRLEVLDSTKSSRESSEARKGFSYLVTAV
TTVGVAYAAKNVVTQFISTMSASADVLAMAKIEIKLSDIPEGKNMTFKWRGKPLFVRHRT
QKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGFYCPCHG
SHYDASGRIRLGPAPLNLEVPPYEFTSDDMVVVG
Download sequence
Identical sequences F6V7Y3
ENSMMUP00000030343 XP_001101289.1.72884 ENSMMUP00000030343 9544.ENSMMUP00000030343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]