SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001101421.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001101421.1.72884
Domain Number 1 Region: 42-222
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.35e-78
Family T-box 0.0000000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001101421.1.72884
Sequence length 377
Comment PREDICTED: brachyury protein isoform X2 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MSSPGTESAGKSLQYRVDHLLSAVESELQAGSEKGDPTERELRVGLEESELWLRFKELTN
EMIVTKNGRRMFPVLKVNVSGLDPNAMYSFLLDFVAADNHRWKYVNGEWVPGGKPEPQAP
SCVYIHPDSPNFGAHWMKAPVSFSKVKLTNKLNGGGQIMLNSLHKYEPRIHIVRVGGPQR
MITSHCFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERSDHKEMMEETGDSQQPG
YSQSCSDNSPACLSMLQSHDNWSSLGMPAHPSMLPVSHNASPPTSSSQYPSLWSVSNGAV
TPGSQAAAMSNGLGAQFFRGSPAHYAPLTHPVSAPSSSGSPLYEGAAAATDIVDSQYDAA
AQGRLIASWTPVSPPSM
Download sequence
Identical sequences A0A2K5UNL2
XP_001101421.1.72884 ENSMMUP00000032924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]