SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001104381.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001104381.1.72884
Domain Number 1 Region: 5-50
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000893
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001104381.1.72884
Sequence length 115
Comment PREDICTED: pro-neuregulin-4, membrane-bound isoform isoform X3 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCIENYTGARCEEVFLPSSSIQTKNN
LFEAFMALAVLITLIIGAFYFLCRKGHFQRASSVQYDVSLVETSSTSAHHSHGEH
Download sequence
Identical sequences A0A2K5TJ77
9544.ENSMMUP00000033410 XP_001104381.1.72884 ENSMMUP00000033410 ENSMMUP00000027477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]